Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM16751 |
---|
Substrate/Competitor | Cathepsin D/Pepsin Peptide Substrate |
---|
Meas. Tech. | FRET-based Peptide Cleavage Assay |
---|
pH | 4.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 60000±11400 nM |
---|
Citation | Cole, DC; Manas, ES; Stock, JR; Condon, JS; Jennings, LD; Aulabaugh, A; Chopra, R; Cowling, R; Ellingboe, JW; Fan, KY; Harrison, BL; Hu, Y; Jacobsen, S; Jin, G; Lin, L; Lovering, FE; Malamas, MS; Stahl, ML; Strand, J; Sukhdeo, MN; Svenson, K; Turner, MJ; Wagner, E; Wu, J; Zhou, P; Bard, J Acylguanidines as small-molecule beta-secretase inhibitors. J Med Chem49:6158-61 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM16751 |
---|
Cathepsin D/Pepsin Peptide Substrate |
---|
Name: | Cathepsin D/Pepsin Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2478.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 21 |
Sequence: | MOCAc-GKPILFFRLK (Dnp)-D-R-NH2
|
|
|