| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM354594 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarisation Assay |
|---|
| IC50 | 2.90±n/a nM |
|---|
| Citation |  Davidson, JE; Murray, JB; Chen, I; Walmsley, C; Dodsworth, M; Meissner, JW; Brough, P; Fejes, I; Tatai, J; Nyerges, M; Kotschy, A; Szlávik, Z; Geneste, O; Le Tiran, A; Le Diguarher, T; Henlin, J; Starck, J; Guillouzic, A; De Nanteuil, G Isoindoline or isoquinoline compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9809574 Publication Date 11/7/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM354594 |
|---|
| n/a |
|---|
| Name | BDBM354594 |
|---|
| Synonyms: | N-Butyl-N-(4-hydroxyphenyl)-1,2-dimethyl-5-{7-[(3S)-3-(morpholin-4-ylmethyl)-1,2,3,4-tetrahydroisoquinoline-2-carbonyl]-2-(2-phenylacetyl)-1,2,3,4-tetrahydroisoquinolin-6-yl}-1H-pyrrole-3-carboxamide | US9809574, Example 232 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H55N5O5 |
|---|
| Mol. Mass. | 793.9915 |
|---|
| SMILES | CCCCN(C(=O)c1cc(-c2cc3CCN(Cc3cc2C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)C(=O)Cc2ccccc2)n(C)c1C)c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
