Reaction Details |
| Report a problem with these data |
Target | Methionine aminopeptidase 2 |
---|
Ligand | BDBM17477 |
---|
Substrate/Competitor | Octapeptide substrate |
---|
Meas. Tech. | MetAP2 Enzyme Activity Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 1400±n/a nM |
---|
Citation | Sheppard, GS; Wang, J; Kawai, M; Fidanze, SD; BaMaung, NY; Erickson, SA; Barnes, DM; Tedrow, JS; Kolaczkowski, L; Vasudevan, A; Park, DC; Wang, GT; Sanders, WJ; Mantei, RA; Palazzo, F; Tucker-Garcia, L; Lou, P; Zhang, Q; Park, CH; Kim, KH; Petros, A; Olejniczak, E; Nettesheim, D; Hajduk, P; Henkin, J; Lesniewski, R; Davidsen, SK; Bell, RL Discovery and optimization of anthranilic acid sulfonamides as inhibitors of methionine aminopeptidase-2: a structural basis for the reduction of albumin binding. J Med Chem49:3832-49 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Methionine aminopeptidase 2 |
---|
Name: | Methionine aminopeptidase 2 |
Synonyms: | Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MAP2_HUMAN | METAP2 | MNPEP | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | P67EIF2 | Peptidase M 2 | p67 |
Type: | Enzyme |
Mol. Mass.: | 52884.45 |
Organism: | Homo sapiens (Human) |
Description: | P50579 |
Residue: | 478 |
Sequence: | MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
|
|
|
BDBM17477 |
---|
Octapeptide substrate |
---|
Name: | Octapeptide substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 819.07 |
Organism: | n/a |
Description: | n/a |
Residue: | 8 |
Sequence: | |