Reaction Details |
| Report a problem with these data |
Target | Methionine aminopeptidase |
---|
Ligand | BDBM17864 |
---|
Substrate/Competitor | Met-Gly-Met-Met |
---|
Meas. Tech. | EcMAP Enzyme Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 3500±n/a nM |
---|
Citation | Evdokimov, AG; Pokross, M; Walter, RL; Mekel, M; Barnett, BL; Amburgey, J; Seibel, WL; Soper, SJ; Djung, JF; Fairweather, N; Diven, C; Rastogi, V; Grinius, L; Klanke, C; Siehnel, R; Twinem, T; Andrews, R; Curnow, A Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors. Proteins66:538-46 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Methionine aminopeptidase |
---|
Name: | Methionine aminopeptidase |
Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
Type: | Enzyme |
Mol. Mass.: | 29326.96 |
Organism: | Escherichia coli (strain K12) |
Description: | Full-length untagged EcMAP was expressed in E. coli. |
Residue: | 264 |
Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
BDBM17864 |
---|
Met-Gly-Met-Met |
---|
Name: | Met-Gly-Met-Met |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 468.65 |
Organism: | n/a |
Description: | n/a |
Residue: | 4 |
Sequence: | |