| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18071 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 9±n/a nM |
|---|
| IC50 | 90±20 nM |
|---|
| Comments | MIC=0.06 ug/mL. |
|---|
| Citation |  MUKHIJA, S; BANDERA, M; PARISI, S; RIGO, S; LIEB, S; LOCIURO, S; GILLESSEN, D; ISLAM, K AR-709-An Investigational diaminopyrimidine: Inhibition, Binding and Mode of Action. Interscience Conference on Antimicrobial Agents in Chemotherapy0:1-1 (2006) |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate Reductase (DHFR) Mutant (I100L) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19700.70 |
|---|
| Organism: | Streptococcus pneumoniae (ATCC49619) |
|---|
| Description: | n/a |
|---|
| Residue: | 168 |
|---|
| Sequence: | MTKKIVAIWAQDEEGVIGKENRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLLPK
RETLILTRNPEEKIDGVATFQDVQSVLDWYQAQEKNLYILGGKQIFQAFEPYLDEVIVTH
IHARVEGDTYFPEELDLSLFETVSSKFYAKDEKNPYDFTIQYRKRKEV
|
|
|
|---|
| BDBM18071 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18071 |
|---|
| Synonyms: | 5-chloro-3-({4-[(2,4-diaminopyrimidin-5-yl)methyl]-6,7-dimethoxy-1-benzofuran-2-yl}methyl)-N,N-dimethyl-1H-indole-2-carboxamide | AR-709 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27ClN6O4 |
|---|
| Mol. Mass. | 534.994 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)c2cc(Cc3c([nH]c4ccc(Cl)cc34)C(=O)N(C)C)oc2c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
