| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18069 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Determination of IC50 |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 13000±n/a nM |
|---|
| Citation |  Chan, DC; Fu, H; Forsch, RA; Queener, SF; Rosowsky, A Design, synthesis, and antifolate activity of new analogues of piritrexim and other diaminopyrimidine dihydrofolate reductase inhibitors with omega-carboxyalkoxy or omega-carboxy-1-alkynyl substitution in the side chain. J Med Chem48:4420-31 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM18069 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18069 |
|---|
| Synonyms: | 5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP) | US10870625, Compound TMP |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18N4O3 |
|---|
| Mol. Mass. | 290.3177 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
