Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18227 |
---|
Substrate/Competitor | BDBM18044 |
---|
Meas. Tech. | Determination of IC50 |
---|
IC50 | 0.35±n/a nM |
---|
Citation | Chan, DC; Fu, H; Forsch, RA; Queener, SF; Rosowsky, A Design, synthesis, and antifolate activity of new analogues of piritrexim and other diaminopyrimidine dihydrofolate reductase inhibitors with omega-carboxyalkoxy or omega-carboxy-1-alkynyl substitution in the side chain. J Med Chem48:4420-31 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 19884.75 |
Organism: | Mycobacterium avium |
Description: | Recombinant Mycobacterium avium DHFR expressed in E. coli. |
Residue: | 181 |
Sequence: | MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
|
|
|
BDBM18227 |
---|
BDBM18044 |
---|
Name | BDBM18227 |
Synonyms: | 2,4-diamino-5-deazapteridine, 6 | 6-[3-({2,4-diamino-5-methylpyrido[2,3-d]pyrimidin-6-yl}methyl)-4-methoxyphenoxy]hexanoic acid | Piritrexim analogue, 8 |
Type | Small organic molecule |
Emp. Form. | C22H27N5O4 |
Mol. Mass. | 425.4809 |
SMILES | COc1ccc(OCCCCCC(O)=O)cc1Cc1cnc2nc(N)nc(N)c2c1C |
Structure |
|