| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18226 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Determination of IC50 |
|---|
| IC50 | 2.2±n/a nM |
|---|
| Citation |  Chan, DC; Fu, H; Forsch, RA; Queener, SF; Rosowsky, A Design, synthesis, and antifolate activity of new analogues of piritrexim and other diaminopyrimidine dihydrofolate reductase inhibitors with omega-carboxyalkoxy or omega-carboxy-1-alkynyl substitution in the side chain. J Med Chem48:4420-31 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM18226 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18226 |
|---|
| Synonyms: | 2,4-diamino-5-deazapteridine, 5 | 5-[3-({2,4-diamino-5-methylpyrido[2,3-d]pyrimidin-6-yl}methyl)-4-methoxyphenoxy]pentanoic acid | Piritrexim analogue, 7 | pyrido[2,3-d]pyrimidine analogue |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N5O4 |
|---|
| Mol. Mass. | 411.4543 |
|---|
| SMILES | COc1ccc(OCCCCC(O)=O)cc1Cc1cnc2nc(N)nc(N)c2c1C |
|---|
| Structure | 
|
|---|
Search and Browse
