Reaction Details |
| Report a problem with these data |
Target | Thymidylate synthase |
---|
Ligand | BDBM18802 |
---|
Substrate/Competitor | BDBM18754 |
---|
Meas. Tech. | Thymidylate Synthase (TS) Assay |
---|
IC50 | >22000±n/a nM |
---|
Citation | Gangjee, A; Jain, HD; Phan, J; Lin, X; Song, X; McGuire, JJ; Kisliuk, RL Dual inhibitors of thymidylate synthase and dihydrofolate reductase as antitumor agents: design, synthesis, and biological evaluation of classical and nonclassical pyrrolo[2,3-d]pyrimidine antifolates(1). J Med Chem49:1055-65 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Thymidylate synthase |
---|
Name: | Thymidylate synthase |
Synonyms: | TS | TSase | TYSY_ECOLI | Thymidylate Synthase (TS) | thyA |
Type: | Enzyme |
Mol. Mass.: | 30475.81 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 264 |
Sequence: | MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
|
|
|
BDBM18802 |
---|
BDBM18754 |
---|
Name | BDBM18802 |
Synonyms: | 2-amino-5-[(4-bromophenyl)sulfanyl]-6-ethyl-3H,4H,7H-pyrrolo[2,3-d]pyrimidin-4-one | Pyrrolo[2,3-d]pyrimidine analogue, 9 |
Type | Small organic molecule |
Emp. Form. | C14H13BrN4OS |
Mol. Mass. | 365.248 |
SMILES | CCc1[nH]c2nc(N)[nH]c(=O)c2c1Sc1ccc(Br)cc1 |
Structure |
|