Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM19808
Substrate/CompetitorBDBM19485
Meas. Tech.In Vitro Enzyme Inhibition Assay
pH5.5±n/a
Temperature295.15±n/a K
Ki 0.6±n/a nM
Citation Marquis RWRu YZeng JTrout RELoCastro SMGribble ADWitherington JFenwick AEGarnier BTomaszek TTew DHemling MEQuinn CJSmith WWZhao BMcQueney MSJanson CAD'Alessio KVeber DF Cyclic ketone inhibitors of the cysteine protease cathepsin K. J Med Chem 44:725-36 (2001) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19808
BDBM19485
NameBDBM19808
Synonyms:benzyl N-[(1S)-1-({1-[(2S)-2-{[(benzyloxy)carbonyl](methyl)amino}-4-methylpentanoyl]-4-oxopyrrolidin-3-yl}carbamoyl)-3-methylbutyl]carbamate | pyrrolidinone analogue, 25
TypeSmall organic molecule
Emp. Form.C33H44N4O7
Mol. Mass.608.7251
SMILESCC(C)C[C@H](NC(=O)OCc1ccccc1)C(=O)NC1CN(CC1=O)C(=O)[C@H](CC(C)C)N(C)C(=O)OCc1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: