new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh affinity nerve growth factor receptor
LigandBDBM364459
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 0.250±n/a nM
Citation Mitchell HWood HBLi CSMao QQi Z TrkA kinase inhibitors, compositions and methods thereof US Patent  US9862707 Publication Date 1/9/2018
More Info.:Get all data from this article,  Assay Method
 
High affinity nerve growth factor receptor
Name:High affinity nerve growth factor receptor
Synonyms:2.7.10.1 | MTC | NTRK1 | Nerve growth factor receptor Trk-A | Neurotrophic tyrosine kinase receptor type 1 | Neurotrophic tyrosine kinase receptor type 1 (TrkA) | Synonyms=MTC | TRK | TRK1-transforming tyrosine kinase protein | TRKA | Trk-A | Tropomyosin alpha-3 chain/High affinity nerve growth factor receptor | Tropomyosin-related kinase A | Tropomyosin-related kinase A (TrkA) | Tyrosine kinase receptor | Tyrosine kinase receptor (Trk) | Tyrosine kinase receptor A | Tyrosine kinase receptor A (Trk A) | Tyrosine kinase receptor A (Trk-A) | Tyrosine kinase receptor A (TrkA) | gp140trk | p140-TrkA
Type:n/a
Mol. Mass.:87498.18
Organism:Homo sapiens (Human)
Description:P04629
Residue:796
Sequence:
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM364459
n/a
NameBDBM364459
Synonyms:(R or S)-2-fluoro-N-[6-(1- hydroxyethyl)-2-phenyl-2H- pyrazolo[4,3-b]pyridin-3-yl]-5-(1- methyl-1H-pyrazol-3-yl)-4- (trifluoromethyl)benzamide, isomer A | US9862707, Example 33 | US9862707, Example 34
TypeSmall organic molecule
Emp. Form.C26H20F4N6O2
Mol. Mass.524.4696
SMILESCC(O)c1cnc2c(NC(=O)c3cc(-c4ccn(C)n4)c(cc3F)C(F)(F)F)n(nc2c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: