Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 7
LigandBDBM160087
Substrate/Competitorn/a
Meas. Tech.P2X7 FLIPR Assay
pH7.4±n/a
IC50 6.90±n/a nM
Commentsextracted
Citation Ameriks MKRech JCSavall BMWall JL Substituted [1,2,4]triazolo[4,3-a]pyrazines as P2X7 modulators US Patent  US10053463 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 7
Name:P2X purinoceptor 7
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:68405.16
Organism:Mus musculus
Description:ChEMBL_1473824
Residue:595
Sequence:
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISS
VHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFVMTNYVKSEGQVQTLCP
EYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPA
LLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGE
NFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDKNTDESFVPGYNFRYAKYYK
ENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLLINTYSS
AFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQQLLGKS
LQVVKGQEVPRPQMDFSDLSRLSLSLHDSPLTPGQSEEIQLLHEEVAPKSGDSPSWCQCG
NCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLVLSRDTLQLLLLYQDPLLVLGEEA
TNSRLRHRAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKTEGQYSGFKYPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM160087
n/a
NameBDBM160087
Synonyms:US10047092, 28 | US10053463, 28 | US9040534, 28
TypeSmall organic molecule
Emp. Form.C17H14ClF3N6O
Mol. Mass.410.781
SMILESC[C@H]1Cn2c(nnc2C(=O)N1Cc1cccc(c1Cl)C(F)(F)F)-c1cc[nH]n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: