| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orotidine-5'-phosphate decarboxylase |
|---|
| Ligand | BDBM21335 |
|---|
| Substrate/Competitor | BDBM21336 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 26000±2 nM |
|---|
| Citation |  Bello, AM; Poduch, E; Liu, Y; Wei, L; Crandall, I; Wang, X; Dyanand, C; Kain, KC; Pai, EF; Kotra, LP Structure-activity relationships of C6-uridine derivatives targeting plasmodia orotidine monophosphate decarboxylase. J Med Chem51:439-48 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Orotidine-5'-phosphate decarboxylase |
|---|
| Name: | Orotidine-5'-phosphate decarboxylase |
|---|
| Synonyms: | ODCase | Orotidine 5-Phosphate Decarboxylase | Orotidine Monophosphate Decarboxylase (ODCase) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37826.43 |
|---|
| Organism: | Plasmodium falciparum (malaria parasite P. falciparum) |
|---|
| Description: | n/a |
|---|
| Residue: | 323 |
|---|
| Sequence: | MGFKVKLEKRRNAINTCLCIGLDPDEKDIENFMKNEKENNYNNIKKNLKEKYINNVSIKK
DILLKAPDNIIREEKSEEFFYFFNHFCFYIINETNKYALTFKMNFAFYIPYGSVGIDVLK
NVFDYLYELNIPTILDMKINDIGNTVKNYRKFIFEYLKSDSCTVNIYMGTNMLKDICYDE
EKNKYYSAFVLVKTTNPDSAIFQKNLSLDNKQAYVIMAQEALNMSSYLNLEQNNEFIGFV
VGANSYDEMNYIRTYFPNCYILSPGIGAQNGDLHKTLTNGYHKSYEKILINIGRAITKNP
YPQKAAQMYYDQINAILKQNMES
|
|
|
|---|
| BDBM21335 |
|---|
| BDBM21336 |
|---|
| Name | BDBM21335 |
|---|
| Synonyms: | 6-cyanouridine 5-monophosphate | C6-Uridine Derivative, 6 | JMC521648 Compound 34 | {[(2R,3S,4R,5R)-5-(6-cyano-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12N3O9P |
|---|
| Mol. Mass. | 349.1907 |
|---|
| SMILES | O[C@@H]1[C@@H](COP(O)(O)=O)O[C@H]([C@@H]1O)n1c(cc(=O)[nH]c1=O)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
