| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [1148-1435] |
|---|
| Ligand | BDBM23400 |
|---|
| Substrate/Competitor | DIG-tagged Target DNA |
|---|
| Meas. Tech. | Integrase 3-End Joining Assay |
|---|
| pH | 7.3±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 26±3 nM |
|---|
| Citation |  Chen, X; Tsiang, M; Yu, F; Hung, M; Jones, GS; Zeynalzadegan, A; Qi, X; Jin, H; Kim, CU; Swaminathan, S; Chen, JM Modeling, analysis, and validation of a novel HIV integrase structure provide insights into the binding modes of potent integrase inhibitors. J Mol Biol380:504-19 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Gag-Pol polyprotein [1148-1435] |
|---|
| Name: | Gag-Pol polyprotein [1148-1435] |
|---|
| Synonyms: | HIV-1 Integrase | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 32171.42 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The sequence encoding the 288-amino-acid wild-type full-length integrase was cloned with an N-terminal 6His tag, and expressed in E. coli. |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM23400 |
|---|
| DIG-tagged Target DNA |
|---|
| Name: | DIG-tagged Target DNA |
|---|
| Synonyms: | digoxin-tagged DNA |
|---|
| Type: | Duplex DNA |
|---|
| Mol. Mass.: | 1978.21 |
|---|
| Organism: | n/a |
|---|
| Description: | The biotinylated donor DNA was bound to streptavidin-coated plates. |
|---|
| Residue: | 23 |
|---|
| Sequence: | 5-TGACCAAGGGCTAATTCACT-3-DIG
|
|
|
|---|
Search and Browse
