Reaction Details |
| Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 [215-477,S266A,N452Q] |
---|
Ligand | BDBM23465 |
---|
Substrate/Competitor | BDBM23453 |
---|
Meas. Tech. | TACE Inhibition Assay |
---|
pH | 7.3±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 50±n/a nM |
---|
Citation | Zhu, Z; Mazzola, R; Sinning, L; McKittrick, B; Niu, X; Lundell, D; Sun, J; Orth, P; Guo, Z; Madison, V; Ingram, R; Beyer, BM Discovery of novel hydroxamates as highly potent tumor necrosis factor-alpha converting enzyme inhibitors: Part I--discovery of two binding modes. J Med Chem51:725-36 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 [215-477,S266A,N452Q] |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 [215-477,S266A,N452Q] |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_HUMAN | ADAM 17 | ADAM17 | CD156b antigen | CSVP | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Single-pass type I membrane protein; metalloprotease |
Mol. Mass.: | 29695.98 |
Organism: | Homo sapiens (Human) |
Description: | The catalytic domain of recombinant human TNF-converting enzyme (residues 215-477) with two mutations (S266A and N452Q) and a 6xHis was purified from the baculovirus/Hi5 cells expression system. |
Residue: | 263 |
Sequence: | RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKG
YGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCL
AHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTI
LTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCS
KQSIYKTIESKAQECFQERSNKV
|
|
|
BDBM23465 |
---|
BDBM23453 |
---|
Name | BDBM23465 |
Synonyms: | hydroxamate deriv., 57 | methyl (1R,2R)-1-{3-[(4-chlorophenyl)methoxy]phenyl}-2-(hydroxycarbamoyl)cyclopropane-1-carboxylate |
Type | Small organic molecule |
Emp. Form. | C19H18ClNO5 |
Mol. Mass. | 375.803 |
SMILES | COC(=O)[C@@]1(C[C@H]1C(=O)NO)c1cccc(OCc2ccc(Cl)cc2)c1 |r| |
Structure |
|