| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP phosphoribosyltransferase |
|---|
| Ligand | BDBM25321 |
|---|
| Substrate/Competitor | BDBM25315 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 8.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Comments | 20% inhibition @ 10 uM. |
|---|
| Citation |  Cho, Y; Ioerger, TR; Sacchettini, JC Discovery of novel nitrobenzothiazole inhibitors for Mycobacterium tuberculosis ATP phosphoribosyl transferase (HisG) through virtual screening. J Med Chem51:5984-92 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| ATP phosphoribosyltransferase |
|---|
| Name: | ATP phosphoribosyltransferase |
|---|
| Synonyms: | ATP-PRT | ATP-PRTase | HIS1_MYCTU | hisG |
|---|
| Type: | Glycosyltransferase |
|---|
| Mol. Mass.: | 30473.85 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 284 |
|---|
| Sequence: | MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
|
|
|
|---|
| BDBM25321 |
|---|
| BDBM25315 |
|---|
| Name | BDBM25321 |
|---|
| Synonyms: | (4E)-4-[(4-chlorophenyl)(hydroxy)methylidene]-1-(pyridin-3-ylmethyl)-5-(3,4,5-trimethoxyphenyl)pyrrolidine-2,3-dione | ChemBridge pyrrolidine-2,3-dione, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23ClN2O6 |
|---|
| Mol. Mass. | 494.924 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)C1C(C(=O)c2ccc(Cl)cc2)C(=O)C(=O)N1Cc1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
