| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP phosphoribosyltransferase |
|---|
| Ligand | BDBM25323 |
|---|
| Substrate/Competitor | BDBM25315 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 8.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 11900±n/a nM |
|---|
| Comments | 46% inhibition @ 10 uM. |
|---|
| Citation |  Cho, Y; Ioerger, TR; Sacchettini, JC Discovery of novel nitrobenzothiazole inhibitors for Mycobacterium tuberculosis ATP phosphoribosyl transferase (HisG) through virtual screening. J Med Chem51:5984-92 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| ATP phosphoribosyltransferase |
|---|
| Name: | ATP phosphoribosyltransferase |
|---|
| Synonyms: | ATP-PRT | ATP-PRTase | HIS1_MYCTU | hisG |
|---|
| Type: | Glycosyltransferase |
|---|
| Mol. Mass.: | 30473.85 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 284 |
|---|
| Sequence: | MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
|
|
|
|---|
| BDBM25323 |
|---|
| BDBM25315 |
|---|
| Name | BDBM25323 |
|---|
| Synonyms: | 2-({7-[(3-hydroxyphenyl)amino]-4-nitro-2,1,3-benzoxadiazol-5-yl}amino)-5-nitrophenol | ChemBridge benzoxadiazole, 18 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12N6O7 |
|---|
| Mol. Mass. | 424.3239 |
|---|
| SMILES | Oc1cccc(Nc2cc(Nc3ccc(cc3O)[N+]([O-])=O)c([N+]([O-])=O)c3nonc23)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
