Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
---|
Ligand | BDBM25376 |
---|
Substrate/Competitor | HIV Protease substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 6.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 19±0.76 nM |
---|
IC50 | >1000±n/a nM |
---|
Citation | Ghosh, AK; Gemma, S; Baldridge, A; Wang, YF; Kovalevsky, AY; Koh, Y; Weber, IT; Mitsuya, H Flexible cyclic ethers/polyethers as novel P2-ligands for HIV-1 protease inhibitors: design, synthesis, biological evaluation, and protein-ligand X-ray studies. J Med Chem51:6021-33 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
---|
Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
BDBM25376 |
---|
HIV Protease substrate |
---|
Name: | HIV Protease substrate |
Synonyms: | Fluorogenic Peptide Substrate |
Type: | Peptide |
Mol. Mass.: | 3467.28 |
Organism: | n/a |
Description: | n/a |
Residue: | 30 |
Sequence: | 2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2
|
|
|