| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Ligand | BDBM25792 |
|---|
| Substrate/Competitor | BDBM15648 |
|---|
| Meas. Tech. | InhA Enzyme Inhibition Assay |
|---|
| pH | 6.8±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| IC50 | 5160±450 nM |
|---|
| Citation |  He, X; Alian, A; Ortiz de Montellano, PR Inhibition of the Mycobacterium tuberculosis enoyl acyl carrier protein reductase InhA by arylamides. Bioorg Med Chem15:6649-58 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
|---|
| Synonyms: | Enoyl-ACP Reductase (InhA) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-[acyl-carrier-protein] reductase [NADH] | INHA_MYCTU | NADH-dependent enoyl-ACP reductase | inhA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28526.00 |
|---|
| Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Description: | P9WGR1 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
|
|
|---|
| BDBM25792 |
|---|
| BDBM15648 |
|---|
| Name | BDBM25792 |
|---|
| Synonyms: | 4-benzyl-1-[(4-methylphenyl)carbonyl]piperidine | piperidine, b3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23NO |
|---|
| Mol. Mass. | 293.4027 |
|---|
| SMILES | Cc1ccc(cc1)C(=O)N1CCC(Cc2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
