| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM26104 |
|---|
| Substrate/Competitor | BDBM13466 |
|---|
| Meas. Tech. | Determination of Inhibitor Ki |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | >50000±n/a nM |
|---|
| Citation |  Soellner, MB; Rawls, KA; Grundner, C; Alber, T; Ellman, JA Fragment-based substrate activity screening method for the identification of potent inhibitors of the Mycobacterium tuberculosis phosphatase PtpB. J Am Chem Soc129:9613-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM26104 |
|---|
| BDBM13466 |
|---|
| Name | BDBM26104 |
|---|
| Synonyms: | 5-{2-cyclohexyl-4-[4-fluoro-3-(trifluoromethyl)phenyl]phenyl}-1,2-oxazole-3-carboxylic acid | Isoxazole carboxylic acid, 19 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H19F4NO3 |
|---|
| Mol. Mass. | 433.3955 |
|---|
| SMILES | OC(=O)c1cc(on1)-c1ccc(cc1C1CCCCC1)-c1ccc(F)c(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
