| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM388323 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Determination of Beta5 Activity |
|---|
| IC50 | 275±n/a nM |
|---|
| Citation |  Klein, M; Schadt, O; Haselmayer, P; Busch, M Substituted boronic acids and boronate esters as immunoproteasome inhibitors US Patent US10294246 Publication Date 5/21/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM388323 |
|---|
| n/a |
|---|
| Name | BDBM388323 |
|---|
| Synonyms: | US10294246, Compound No. 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16BN3O4 |
|---|
| Mol. Mass. | 325.127 |
|---|
| SMILES | OB(O)[C@H](Cc1coc2ccccc12)NC(=O)Cc1ncccn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
