| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM26962 |
|---|
| Substrate/Competitor | BDBM21865 |
|---|
| Meas. Tech. | Receptor Binding Assay |
|---|
| Ki | 930±n/a nM |
|---|
| Citation |  Okano, M; Mito, J; Maruyama, Y; Masuda, H; Niwa, T; Nakagawa, S; Nakamura, Y; Matsuura, A Discovery and structure-activity relationships of 4-aminoquinazoline derivatives, a novel class of opioid receptor like-1 (ORL1) antagonists. Bioorg Med Chem17:119-32 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM26962 |
|---|
| BDBM21865 |
|---|
| Name | BDBM26962 |
|---|
| Synonyms: | 4-aminoquinazoline derivative, 7e | N-(6-aminohexyl)-2-[(E)-2-(4-chlorophenyl)ethenyl]-8-methylquinazolin-4-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27ClN4 |
|---|
| Mol. Mass. | 394.94 |
|---|
| SMILES | Cc1cccc2c(NCCCCCCN)nc(\C=C\c3ccc(Cl)cc3)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
