Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM27774
Substrate/CompetitorBDBM25143
Meas. Tech.HDAC Activity Assay
pH8±n/a
Temperature310.15±n/a K
IC50 4±n/a nM
Citation Kattar SDSurdi LMZabierek AMethot JLMiddleton REHughes BSzewczak AADahlberg WKKral AMOzerova NFleming JCWang HSecrist PHarsch AHamill JECruz JCKenific CMChenard MMiller TABerk SCTempest P Parallel medicinal chemistry approaches to selective HDAC1/HDAC2 inhibitor (SHI-1:2) optimization. Bioorg Med Chem Lett 19:1168-72 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Q13547
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27774
BDBM25143
NameBDBM27774
Synonyms:N-[2-amino-5-(thiophen-2-yl)phenyl]-4-{1,8-diazaspiro[4.5]decan-8-ylmethyl}benzamide | biphenyl diamine analogue, 22
TypeSmall organic molecule
Emp. Form.C26H30N4OS
Mol. Mass.446.608
SMILESNc1ccc(cc1NC(=O)c1ccc(CN2CCC3(CCCN3)CC2)cc1)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: