| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Ligand | BDBM27931 |
|---|
| Substrate/Competitor | BDBM17342 |
|---|
| Meas. Tech. | Fluorescence Polarization Affinity Measurements |
|---|
| Ki | 1500±n/a nM |
|---|
| Citation |  Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ Orally bioavailable antagonists of inhibitor of apoptosis proteins based on an azabicyclooctane scaffold. J Med Chem52:1723-30 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
|---|
| Type: | Protein Binding Domain |
|---|
| Mol. Mass.: | 13276.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BIR3 of XIAP: RESIDUES 241-356. |
|---|
| Residue: | 116 |
|---|
| Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
|---|
| BDBM27931 |
|---|
| BDBM17342 |
|---|
| Name | BDBM27931 |
|---|
| Synonyms: | Azabicyclooctane scaffold, 14n | N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-1H-1,2,3-benzotriazole-5-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H35N7O3 |
|---|
| Mol. Mass. | 469.5798 |
|---|
| SMILES | [H][C@]12CC[C@H](NC(=O)c3ccc4nn[nH]c4c3)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
