Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 2 [266-354] |
---|
Ligand | BDBM27919 |
---|
Substrate/Competitor | BDBM17342 |
---|
Meas. Tech. | Fluorescence Polarization Affinity Measurements |
---|
Ki | 33±n/a nM |
---|
Citation | Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ Orally bioavailable antagonists of inhibitor of apoptosis proteins based on an azabicyclooctane scaffold. J Med Chem52:1723-30 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 2 [266-354] |
---|
Name: | Baculoviral IAP repeat-containing protein 2 [266-354] |
Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Chimeric protein of inhibitor of apoptosis protein 2-baculovirus IAP repeat 3 (BIR3) | MIHB | RNF48 | cIAP1-BIR3 | cIAP1-BIR3/XIAP-BIR3 chimeric protein | cIAP1XBIR3 |
Type: | Chimeric Protein |
Mol. Mass.: | 10496.31 |
Organism: | Homo sapiens (Human) |
Description: | Q13490[266-354] |
Residue: | 89 |
Sequence: | MQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVE
HAKWFPRCEFLIRMKGQEFVDEIQGRYPH
|
|
|
BDBM27919 |
---|
BDBM17342 |
---|
Name | BDBM27919 |
Synonyms: | Azabicyclooctane scaffold, 14b | N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]naphthalene-1-carboxamide |
Type | Small organic molecule |
Emp. Form. | C28H38N4O3 |
Mol. Mass. | 478.6263 |
SMILES | [H][C@]12CC[C@H](NC(=O)c3cccc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| |
Structure |
|