| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM392664 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Test for Evaluating Human MC Receptor Activation, Using Cells Expressing Human MC4, MC1, or MC3 Receptor |
|---|
| EC50 | 6400±n/a nM |
|---|
| Citation |  Sugane, T; Makino, T; Yamashita, D; Yonetoku, Y; Tanabe, D; Mihara, H; Asai, N; Osoda, K; Shimizu, T; Moritomo, H; Sugasawa, K; Maeno, K; Hosogai, N Piperazine derivative US Patent US10301286 Publication Date 5/28/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34717.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01726 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
|---|
| BDBM392664 |
|---|
| n/a |
|---|
| Name | BDBM392664 |
|---|
| Synonyms: | US10301286, Example 6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41F2N3O3 |
|---|
| Mol. Mass. | 577.7044 |
|---|
| SMILES | C[C@H]1CN(C[C@@H](C)N1C(=O)[C@@H]1CN(C[C@H]1c1ccc(F)cc1F)C(C)(C)C)[C@@H](Cc1ccc2ccccc2c1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
