| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM29981 |
|---|
| Substrate/Competitor | BDBM29961 |
|---|
| Meas. Tech. | Radioligand Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 8.2±n/a nM |
|---|
| Citation |  Kobayashi, K; Uchiyama, M; Ito, H; Takahashi, H; Yoshizumi, T; Sakoh, H; Nagatomi, Y; Asai, M; Miyazoe, H; Tsujita, T; Hirayama, M; Ozaki, S; Tani, T; Ishii, Y; Ohta, H; Okamoto, O Discovery of novel arylpyrazole series as potent and selective opioid receptor-like 1 (ORL1) antagonists. Bioorg Med Chem Lett19:3627-31 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM29981 |
|---|
| BDBM29961 |
|---|
| Name | BDBM29981 |
|---|
| Synonyms: | arylpyrazole, 26 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23Cl2N5 |
|---|
| Mol. Mass. | 416.347 |
|---|
| SMILES | Cc1c(CNC2CCCC2)nn(c1-c1ccc(C)nc1)-c1ncc(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
