| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM31802 |
|---|
| Substrate/Competitor | Bak-BH3 peptide |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| IC50 | 3700±n/a nM |
|---|
| Kd | 1700±n/a nM |
|---|
| Comments | Kd was obtained using ITC assay. |
|---|
| Citation |  Wei, J; Kitada, S; Rega, MF; Stebbins, JL; Zhai, D; Cellitti, J; Yuan, H; Emdadi, A; Dahl, R; Zhang, Z; Yang, L; Reed, JC; Pellecchia, M Apogossypol derivatives as pan-active inhibitors of antiapoptotic B-cell lymphoma/leukemia-2 (Bcl-2) family proteins. J Med Chem52:4511-23 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM31802 |
|---|
| Bak-BH3 peptide |
|---|
| Name: | Bak-BH3 peptide |
|---|
| Synonyms: | F-BakBH3 |
|---|
| Type: | Fluorescein-labeled peptide |
|---|
| Mol. Mass.: | 1724.92 |
|---|
| Organism: | n/a |
|---|
| Description: | Derived from human apoptosis regulator BAK (residues 72-87). |
|---|
| Residue: | 16 |
|---|
| Sequence: | |
|---|
Search and Browse
