Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src [251-533,T338M] |
---|
Ligand | BDBM31830 |
---|
Substrate/Competitor | biotinylated poly-Glu-Tyr |
---|
Meas. Tech. | Kinetics Assay for IC50 Determination |
---|
pH | 7±n/a |
---|
Temperature | 296.15±n/a K |
---|
Comments | No binding. |
---|
Citation | Getlik, M; Grütter, C; Simard, JR; Klüter, S; Rabiller, M; Rode, HB; Robubi, A; Rauh, D Hybrid compound design to overcome the gatekeeper T338M mutation in cSrc. J Med Chem52:3915-26 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src [251-533,T338M] |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src [251-533,T338M] |
Synonyms: | Proto-oncogene tyrosine-protein kinase Src | SRC | SRC_CHICK | Src Mutant (T338M) |
Type: | Tyr protein kinase |
Mol. Mass.: | 32390.51 |
Organism: | Gallus gallus (Chicken) |
Description: | Mutation of T338M was introduced by site-directed mutagenesis and confirmed by sequence analysis. |
Residue: | 283 |
Sequence: | QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQE
AQVMKKLRHEKLVQLYAVVSEEPIYIVMEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQI
ASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTA
PEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM31830 |
---|
biotinylated poly-Glu-Tyr |
---|
Name: | biotinylated poly-Glu-Tyr |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |