Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src [251-533,T338M,S345C] |
---|
Ligand | BDBM5446 |
---|
Substrate/Competitor | Tyr 02 Substrate Peptide |
---|
Meas. Tech. | Src IC50 Determination |
---|
pH | 7.5±n/a |
---|
Temperature | 296.15±n/a K |
---|
IC50 | 15000±n/a nM |
---|
Citation | Michalczyk, A; Klüter, S; Rode, HB; Simard, JR; Grütter, C; Rabiller, M; Rauh, D Structural insights into how irreversible inhibitors can overcome drug resistance in EGFR. Bioorg Med Chem16:3482-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src [251-533,T338M,S345C] |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src [251-533,T338M,S345C] |
Synonyms: | Proto-oncogene tyrosine-protein kinase Src | SRC | SRC_CHICK | Src Mutant (S345C/T338M) | cSRC-DM |
Type: | Tyr protein kinase |
Mol. Mass.: | 32732.47 |
Organism: | Gallus gallus (Chicken) |
Description: | Mutations of T338 to methionine and S345 to cysteine were introduced by site-directed mutagenesis and confirmed by sequence analysis. |
Residue: | 286 |
Sequence: | GHMQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAF
LQEAQVMKKLRHEKLVQLYAVVSEEPIYIVMEYMSKGCLLDFLKGEMGKYLRLPQLVDMA
AQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIK
WTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC
PESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM5446 |
---|
Tyr 02 Substrate Peptide |
---|
Name: | Tyr 02 Substrate Peptide |
Synonyms: | n/a |
Type: | FRET-peptide substrate |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |