Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSrc Mutant (S345C/T338M)
LigandBDBM5446
Substrate/CompetitorTyr 02 Substrate Peptide
Meas. Tech.Src IC50 Determination
pH7.5±n/a
Temperature296.15±n/a K
IC50 15000±n/a nM
Citation Michalczyk AKlüter SRode HBSimard JRGrütter CRabiller MRauh D Structural insights into how irreversible inhibitors can overcome drug resistance in EGFR. Bioorg Med Chem 16:3482-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Src Mutant (S345C/T338M)
Name:Src Mutant (S345C/T338M)
Synonyms:Proto-oncogene tyrosine-protein kinase Src | cSRC-DM
Type:Tyr protein kinase
Mol. Mass.:32732.47
Organism:Gallus gallus (Chicken)
Description:Mutations of T338 to methionine and S345 to cysteine were introduced by site-directed mutagenesis and confirmed by sequence analysis.
Residue:286
Sequence:
GHMQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAF
LQEAQVMKKLRHEKLVQLYAVVSEEPIYIVMEYMSKGCLLDFLKGEMGKYLRLPQLVDMA
AQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIK
WTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC
PESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5446
Tyr 02 Substrate Peptide
Name:Tyr 02 Substrate Peptide
Synonyms:n/a
Type:FRET-peptide substrate
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a