Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 3 [255-322] |
---|
Ligand | BDBM32578 |
---|
Substrate/Competitor | BDBM17342 |
---|
Meas. Tech. | Fluorescence Polarization Affinity Measurements |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 52±n/a nM |
---|
Citation | Ndubaku, C; Varfolomeev, E; Wang, L; Zobel, K; Lau, K; Elliott, LO; Maurer, B; Fedorova, AV; Dynek, JN; Koehler, M; Hymowitz, SG; Tsui, V; Deshayes, K; Fairbrother, WJ; Flygare, JA; Vucic, D Antagonism of c-IAP and XIAP proteins is required for efficient induction of cell death by small-molecule IAP antagonists. ACS Chem Biol4:557-66 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 3 [255-322] |
---|
Name: | Baculoviral IAP repeat-containing protein 3 [255-322] |
Synonyms: | API2 | Apoptosis inhibitor 2 | BIRC3 | BIRC3_HUMAN | Baculoviral IAP repeat-containing protein 3 | Inhibitor of apoptosis protein 1 | MIHC | RNF49 | cIAP-2 BIR3 |
Type: | BIR3 domain |
Mol. Mass.: | 7852.71 |
Organism: | Homo sapiens (Human) |
Description: | Q13489[255-322] |
Residue: | 68 |
Sequence: | HAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAK
WFPRCEYL
|
|
|
BDBM32578 |
---|
BDBM17342 |
---|
Name | BDBM32578 |
Synonyms: | CS-1 |
Type | Small organic molecule |
Emp. Form. | C28H40N6O3 |
Mol. Mass. | 508.6556 |
SMILES | CN[C@@H](C)C(=O)N[C@@H](C1CCCCC1)C(=O)N1CC[C@H](C)[C@H]1C(=O)Nc1cc(C)nn1-c1ccccc1 |r| |
Structure |
|