| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM33265 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 7.6±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| Ki | 3200±500 nM |
|---|
| Citation |  Ganesh, VK; Muller, N; Judge, K; Luan, CH; Padmanabhan, R; Murthy, KH Identification and characterization of nonsubstrate based inhibitors of the essential dengue and West Nile virus proteases. Bioorg Med Chem13:257-64 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM33265 |
|---|
| BDBM10852 |
|---|
| Name | BDBM33265 |
|---|
| Synonyms: | guanidine, 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H13N4O2P |
|---|
| Mol. Mass. | 240.1989 |
|---|
| SMILES | [#6]-c1ccc(cc1)-[#6](=[#7]\[#7]=[#6](\[#7])-[#7])-[#15](-[#8])-[#8] |w:8.9| |
|---|
| Structure | 
|
|---|
Search and Browse
