Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
---|
Ligand | BDBM803 |
---|
Substrate/Competitor | Fluorogenic substrate Abz-NF-6* |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 6.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
Comments | Ki is not determined. |
---|
Citation | Glenn, MP; Pattenden, LK; Reid, RC; Tyssen, DP; Tyndall, JD; Birch, CJ; Fairlie, DP Beta-strand mimicking macrocyclic amino acids: templates for protease inhibitors with antiviral activity. J Med Chem45:371-81 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
---|
Name: | Dimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
Synonyms: | HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | HIV-1 Protease chain B | POL_HV1A2 | Synthetic HIV PR (SF2 isolate) | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10586.91 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03369[491-589,Q7K,L33I,C67B,C95B] |
Residue: | 97 |
Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B] |
Synonyms: | HIV-1 Mutant (C67B, C95B, Q7K, L33I, where B is L-R-amino-nbutyric acid) | HIV-1 Protease chain B | POL_HV1A2 | Synthetic HIV PR (SF2 isolate) | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10586.91 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P03369[491-589,Q7K,L33I,C67B,C95B] |
Residue: | 97 |
Sequence: | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEIGHKAIGTVLVGPTPVNIIGRNLLTQIGTLNF
|
|
|
BDBM803 |
---|
Fluorogenic substrate Abz-NF-6* |
---|
Name: | Fluorogenic substrate Abz-NF-6* |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |