| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vasopressin V2 receptor |
|---|
| Ligand | BDBM35680 |
|---|
| Substrate/Competitor | BDBM35667 |
|---|
| Meas. Tech. | Binding Assay for Human V2 Receptor |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| Ki | 11±n/a nM |
|---|
| Citation |  Tsukamoto, I; Koshio, H; Kuramochi, T; Saitoh, C; Yanai-Inamura, H; Kitada-Nozawa, C; Yamamoto, E; Yatsu, T; Shimada, Y; Sakamoto, S; Tsukamoto, S Synthesis and structure-activity relationships of amide derivatives of (4,4-difluoro-1,2,3,4-tetrahydro-5H-1-benzazepin-5-ylidene)acetic acid as selective arginine vasopressin V2 receptor agonists. Bioorg Med Chem17:3130-41 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Vasopressin V2 receptor |
|---|
| Name: | Vasopressin V2 receptor |
|---|
| Synonyms: | ADHR | AVPR V2 | AVPR2 | Antidiuretic hormone receptor | DIR | DIR3 | Renal-type arginine vasopressin receptor | V2R | V2R_HUMAN | VASOPRESSIN V2 | Vasopressin V2 receptor | Vasopressin receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 40295.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30518 |
|---|
| Residue: | 371 |
|---|
| Sequence: | MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
|
|
|
|---|
| BDBM35680 |
|---|
| BDBM35667 |
|---|
| Name | BDBM35680 |
|---|
| Synonyms: | 5H-1-benzazepin-5-ylidene acetamide, 1h |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H29ClF2N6O2 |
|---|
| Mol. Mass. | 591.051 |
|---|
| SMILES | CN(C)c1cccc(CNC(=O)\C=C2\c3ccccc3N(CCC2(F)F)C(=O)c2ccc(cc2Cl)-n2ccc(C)n2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
