Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM40775 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Ki | 3200±0.0 nM |
---|
Citation | Chen, CA; Sieburth, SM; Glekas, A; Hewitt, GW; Trainor, GL; Erickson-Viitanen, S; Garber, SS; Cordova, B; Jeffry, S; Klabe, RM Drug design with a new transition state analog of the hydrated carbonyl: silicon-based inhibitors of the HIV protease. Chem Biol8:1161-6 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 protease wild type |
Type: | Protein |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus |
Description: | O90785 |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM40775 |
---|
n/a |
---|
Name | BDBM40775 |
Synonyms: | Carbinol, 18a |
Type | Small organic molecule |
Emp. Form. | C35H38N2O3 |
Mol. Mass. | 534.6878 |
SMILES | OC(C[C@@H](Cc1ccccc1)C(=O)NCc1ccccc1)C[C@@H](Cc1ccccc1)C(=O)NCc1ccccc1 |r| |
Structure |
|