Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM586097 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 5.6±0 |
---|
Temperature | 310.15±0 K |
---|
IC50 | >50±0.5 nM |
---|
Citation | Brik, A; Lin, YC; Elder, J; Wong, CH A quick diversity-oriented amide-forming reaction to optimize P-subsite residues of HIV protease inhibitors. Chem Biol9:891-6 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | HIV-1 protease wild type |
Type: | Protein |
Mol. Mass.: | 10757.68 |
Organism: | Human immunodeficiency virus |
Description: | O90785 |
Residue: | 99 |
Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
BDBM586097 |
---|
n/a |
---|
Name | BDBM586097 |
Synonyms: | P3-P3' Entry 15 |
Type | n/a |
Emp. Form. | C48H64N6O10 |
Mol. Mass. | 885.056 |
SMILES | CC(C)[C@H](NC(=O)c1ccc(CN2CCOCC2)o1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)c1ccc(CN2CCOCC2)o1)C(C)C |
Structure |
|