| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Ligand | BDBM53467 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Activity Assay |
|---|
| pH | 7.6±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| IC50 | 1.7e+4±n/a nM |
|---|
| Citation |  Liu, Y; Lashuel, HA; Choi, S; Xing, X; Case, A; Ni, J; Yeh, LA; Cuny, GD; Stein, RL; Lansbury, PT Discovery of inhibitors that elucidate the role of UCH-L1 activity in the H1299 lung cancer cell line. Chem Biol10:837-46 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Name: | Ubiquitin carboxyl-terminal hydrolase isozyme L3 |
|---|
| Synonyms: | UCH-L3 | UCHL3_MOUSE | Ubiquitin carboxyl-terminal hydrolase isozyme L3 (UCH-L3) | Ubiquitin thioesterase L3 | Uchl3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26139.77 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | Q9JKB1 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
|
|
|
|---|
| BDBM53467 |
|---|
| n/a |
|---|
| Name | BDBM53467 |
|---|
| Synonyms: | 1,3-Dimethyl-5-nitro-6-[2-(4-propoxy-phenyl)-vinyl]-1H-pyrimidine-2,4-dione | 1,3-dimethyl-5-nitro-6-[(E)-2-(4-propoxyphenyl)ethenyl]pyrimidine-2,4-dione | 1,3-dimethyl-5-nitro-6-[(E)-2-(4-propoxyphenyl)vinyl]pyrimidine-2,4-quinone | MLS001208899 | O-acyl oxime isatin derivative, 50 | SMR000518345 | cid_5350691 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19N3O5 |
|---|
| Mol. Mass. | 345.3499 |
|---|
| SMILES | CCCOc1ccc(\C=C\c2c([N+]([O-])=O)c(=O)n(C)c(=O)n2C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
