new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMKP-3
LigandBDBM4078
Substrate/Competitorn/a
Meas. Tech.MKP-3 in vitro HTS assay
IC50 39500±n/a nM
Citation PubChem PC MKP-3 in vitro HTS assay PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MKP-3
Name:MKP-3
Synonyms:MAP kinase phosphatase 3 | Mitogen-activated protein kinase phosphatase 3
Type:Enzyme
Mol. Mass.:42303.19
Organism:Rattus norvegicus
Description:gi_16758752
Residue:381
Sequence:
MIDTLRPVPFASEMAISKTVAWLNEQLELGNEQLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTAPSNQNVYQVDSLQST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4078
n/a
NameBDBM4078
Synonyms:6,7,13,14-tetrahydroxy-2,9-dioxatetracyclo[6.6.2.0^{4,16}.0^{11,15}]hexadeca-1(14),4(16),5,7,11(15),12-hexaene-3,10-dione | CHEMBL6246 | ELLAGIC ACID | Elagic Acid | Ellagic acid (18) | Ellagic acid dihydrate | MLS000069632 | SMR000058244 | cid_5281855
TypeSmall organic molecule
Emp. Form.C14H6O8
Mol. Mass.302.1926
SMILESOc1cc2c3c(oc(=O)c4cc(O)c(O)c(oc2=O)c34)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: