Reaction Details |
| Report a problem with these data |
Target | Guanyl-specific ribonuclease T1 |
---|
Ligand | BDBM55008 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. |
---|
IC50 | >55688±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Guanyl-specific ribonuclease T1 |
---|
Name: | Guanyl-specific ribonuclease T1 |
Synonyms: | RNT1_ASPOR | rntA | unnamed protein product |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13952.57 |
Organism: | Aspergillus oryzae |
Description: | gi_83774548 |
Residue: | 130 |
Sequence: | MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVG
SNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTG
ASGNNFVECT
|
|
|
BDBM55008 |
---|
n/a |
---|
Name | BDBM55008 |
Synonyms: | CEFSULODIN SODIUM SALT | MLS000069560 | SMR000058798 | cid_5458165 | sodium;(6R,7R)-3-[(4-aminocarbonylpyridin-1-ium-1-yl)methyl]-8-oxidanylidene-7-[(2-phenyl-2-sulfonato-ethanoyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-3-[(4-carbamoyl-1-pyridin-1-iumyl)methyl]-8-oxo-7-[(1-oxo-2-phenyl-2-sulfonatoethyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-3-[(4-carbamoylpyridin-1-ium-1-yl)methyl]-8-keto-7-[(2-phenyl-2-sulfonato-acetyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-3-[(4-carbamoylpyridin-1-ium-1-yl)methyl]-8-oxo-7-[(2-phenyl-2-sulfonatoacetyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate |
Type | Small organic molecule |
Emp. Form. | C22H19N4O8S2 |
Mol. Mass. | 531.539 |
SMILES | NC(=O)c1cc[n+](CC2=C(N3[C@H](SC2)[C@H](NC(=O)C(c2ccccc2)S([O-])(=O)=O)C3=O)C([O-])=O)cc1 |t:8| |
Structure |
|