Reaction Details |
| Report a problem with these data |
Target | Guanyl-specific ribonuclease T1 |
---|
Ligand | BDBM55013 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. |
---|
IC50 | 237.68±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of tRNA 2'-phosphotransferase (TPT1): fluorescence polarization-based biochemical high throughput dose response assay to identify inhibitors of RNAse T1. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Guanyl-specific ribonuclease T1 |
---|
Name: | Guanyl-specific ribonuclease T1 |
Synonyms: | RNT1_ASPOR | rntA | unnamed protein product |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13952.57 |
Organism: | Aspergillus oryzae |
Description: | gi_83774548 |
Residue: | 130 |
Sequence: | MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVG
SNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTG
ASGNNFVECT
|
|
|
BDBM55013 |
---|
n/a |
---|
Name | BDBM55013 |
Synonyms: | 2-[(5Z)-5-(3-chloro-4-hydroxy-5-methoxy-benzylidene)-2,4-diketo-thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | 2-[(5Z)-5-[(3-chloranyl-5-methoxy-4-oxidanyl-phenyl)methylidene]-2,4-bis(oxidanylidene)-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)ethanamide | 2-[(5Z)-5-[(3-chloro-4-hydroxy-5-methoxyphenyl)methylidene]-2,4-dioxo-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | 2-[(5Z)-5-[(3-chloro-4-hydroxy-5-methoxyphenyl)methylidene]-2,4-dioxo-3-thiazolidinyl]-N-(2-fluorophenyl)acetamide | 2-[5-(3-chloro-4-hydroxy-5-methoxybenzylidene)-2,4-dioxo-1,3-thiazolidin-3-yl]-N-(2-fluorophenyl)acetamide | MLS000974649 | SMR000497148 | cid_1322017 |
Type | Small organic molecule |
Emp. Form. | C19H14ClFN2O5S |
Mol. Mass. | 436.841 |
SMILES | COc1cc(\C=C2/SC(=O)N(CC(=O)Nc3ccccc3F)C2=O)cc(Cl)c1O |
Structure |
|