new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6
LigandBDBM50293743
Substrate/Competitorn/a
Meas. Tech.Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR6
EC50 5360±n/a nM
Citation PubChem PC Modulation of the Metabotropic Glutamate Receptor mGluR4: Selectivity at mGluR6 PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Metabotropic glutamate receptor 6
Name:Metabotropic glutamate receptor 6
Synonyms:GRM6 | Metabotropic glutamate receptor 6 | glutamate receptor, metabotropic 6 precursor | mGluR6 | metabotropic glutamate 6
Type:Enzyme Catalytic Domain
Mol. Mass.:95479.26
Organism:Homo sapiens (Human)
Description:metabotropic glutamate 6 GRM6 HUMAN::O15303
Residue:877
Sequence:
MARPRRAREPLLVALLPLAWLAQAGLARAAGSVRLAGGLTLGGLFPVHARGAAGRACGQL
KKEQGVHRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGR
GDGDEVGVRCPGGVPPLRPAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPE
LSDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREA
GGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIIIFANEDDIRRVLEAARQANLTGH
FLWVGSDSWGAKTSPILSLEDVAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEF
WEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVYAIAHALHSMHQ
ALCPGHTGLCPAMEPTDGRMLLQYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNG
SASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHC
EACDGYRFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIVAT
TTVVATFVRYNNTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPGAAVCAARRLFLGLG
TTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFSLTSLQVVGMIAWLGARP
PHSVIDYEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFN
EAKPIGFTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKT
YVILFHPEQNVQKRKRSLKATSTVAAPPKGEDAEAHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293743
n/a
NameBDBM50293743
Synonyms:CHEMBL556667 | N-(3-chlorophenyl)picolinamide | cid_836002
TypeSmall organic molecule
Emp. Form.C12H9ClN2O
Mol. Mass.232.666
SMILESClc1cccc(NC(=O)c2ccccn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: