| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 60S ribosomal protein L19-A |
|---|
| Ligand | BDBM50080528 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits |
|---|
| EC50 | 644±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically RPL19A based on MLPCN hits PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 60S ribosomal protein L19-A |
|---|
| Name: | 60S ribosomal protein L19-A |
|---|
| Synonyms: | RL19A_YEAST | RPL19A | RPL23A | YL14A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21739.62 |
|---|
| Organism: | Saccharomyces cerevisiae |
|---|
| Description: | gi_536029 |
|---|
| Residue: | 189 |
|---|
| Sequence: | MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
|
|
|
|---|
| BDBM50080528 |
|---|
| n/a |
|---|
| Name | BDBM50080528 |
|---|
| Synonyms: | 3-((R)-2-((1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl)-2-hydroxyethyl)glutarimide | 4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}piperidine-2,6-dione | CHEMBL123292 | Cycloheximid | Zykloheximid | cid_6197 | cycloheximide | med.21724, Compound Cycloheximide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23NO4 |
|---|
| Mol. Mass. | 281.3474 |
|---|
| SMILES | C[C@H]1C[C@H](C)C(=O)[C@@H](C1)[C@H](O)CC1CC(=O)NC(=O)C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
