Reaction Details |
| Report a problem with these data |
Target | HIV-1 protease |
---|
Ligand | BDBM81673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
Ki | 58±0.0 nM |
---|
Citation | Chellappan, S; Kiran Kumar Reddy, GS; Ali, A; Nalam, MN; Anjum, SG; Cao, H; Kairys, V; Fernandes, MX; Altman, MD; Tidor, B; Rana, TM; Schiffer, CA; Gilson, MK Design of mutation-resistant HIV protease inhibitors with the substrate envelope hypothesis. Chem Biol Drug Des69:298-313 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HIV-1 protease |
---|
Name: | HIV-1 protease |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 10653.94 |
Organism: | Human immunodeficiency virus |
Description: | O90783 |
Residue: | 98 |
Sequence: | PQVTLWQRPLVTIRVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNIIGRNLLTIGCTLNF
|
|
|
BDBM81673 |
---|
n/a |
---|
Name | BDBM81673 |
Synonyms: | CARB-KB45 |
Type | Small organic molecule |
Emp. Form. | C23H31N3O6S |
Mol. Mass. | 477.574 |
SMILES | CNC(=O)CCC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC1CC1)S(=O)(=O)c1ccco1 |r| |
Structure |
|