| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-2C adrenergic receptor |
|---|
| Ligand | BDBM30993 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.71±n/a nM |
|---|
| Comments | PDSP_1589 |
|---|
| Citation |  Bylund, DB; Blaxall, HS; Iversen, LJ; Caron, MG; Lefkowitz, RJ; Lomasney, JW Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol42:1-5 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Alpha-2C adrenergic receptor |
|---|
| Name: | Alpha-2C adrenergic receptor |
|---|
| Synonyms: | ADRA2C | adrenergic Alpha2C |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27257.01 |
|---|
| Organism: | OK |
|---|
| Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
|---|
| BDBM30993 |
|---|
| n/a |
|---|
| Name | BDBM30993 |
|---|
| Synonyms: | Ajmalicine | MLS000111555 | Raubasine | SMR000107477 | cid_251561 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N2O3 |
|---|
| Mol. Mass. | 352.4269 |
|---|
| SMILES | COC(=O)C1=COC(C)C2CN3CCc4c([nH]c5ccccc45)C3CC12 |t:4| |
|---|
| Structure | 
|
|---|
Search and Browse
