| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine 1D receptor |
|---|
| Ligand | BDBM81780 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_1752 |
|---|
| Citation |  Rinaldi-Carmona, M; Congy, C; Santucci, V; Simiand, J; Gautret, B; Neliat, G; Labeeuw, B; Le Fur, G; Soubrie, P; Breliere, JC Biochemical and pharmacological properties of SR 46349B, a new potent and selective 5-hydroxytryptamine2 receptor antagonist. J Pharmacol Exp Ther262:759-68 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine 1D receptor |
|---|
| Name: | 5-hydroxytryptamine 1D receptor |
|---|
| Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12731.52 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | Q8MI13 |
|---|
| Residue: | 119 |
|---|
| Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
|---|
| BDBM81780 |
|---|
| n/a |
|---|
| Name | BDBM81780 |
|---|
| Synonyms: | CAS_6438382 | NSC_6438382 | SR 46349B |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H21FN2O2 |
|---|
| Mol. Mass. | 328.3806 |
|---|
| SMILES | CN(C)CCON=C(C=Cc1ccc(O)cc1)c1ccccc1F |w:6.5,8.7| |
|---|
| Structure | 
|
|---|
Search and Browse
