| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-2C adrenergic receptor |
|---|
| Ligand | BDBM81772 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 13±n/a nM |
|---|
| Comments | PDSP_327 |
|---|
| Citation |  Blaxall, HS; Murphy, TJ; Baker, JC; Ray, C; Bylund, DB Characterization of the alpha-2C adrenergic receptor subtype in the opossum kidney and in the OK cell line. J Pharmacol Exp Ther259:323-9 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Alpha-2C adrenergic receptor |
|---|
| Name: | Alpha-2C adrenergic receptor |
|---|
| Synonyms: | ADRA2C | adrenergic Alpha2C |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27257.01 |
|---|
| Organism: | OK |
|---|
| Description: | adrenergic Alpha2C ADRA2C OK::G3GWB4 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIV
AVWLISAVISFPPLVSFYRRSDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARI
YRFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREAC
QLPEPLFKFFFWIGYCKSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
|
|
|
|---|
| BDBM81772 |
|---|
| n/a |
|---|
| Name | BDBM81772 |
|---|
| Synonyms: | ARC-239 | CAS_122211 | NSC_122211 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N2O3 |
|---|
| Mol. Mass. | 406.5173 |
|---|
| SMILES | COc1ccccc1N1CCN(CCC2C(=O)c3ccccc3C(C)(C)C2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
