| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50298809 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| IC50 | 6.4±0.0 nM |
|---|
| Citation |  Liu, J; Bolstad, DB; Smith, AE; Priestley, ND; Wright, DL; Anderson, AC Probing the active site of Candida glabrata dihydrofolate reductase with high resolution crystal structures and the synthesis of new inhibitors. Chem Biol Drug Des73:62-74 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate Reductase (DHFR) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25053.64 |
|---|
| Organism: | Candida Glabrata |
|---|
| Description: | Q6FPH0 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MSKVPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTNDNSKQNVVIMGRKTWE
SIPQKFRPLPKRINVVVSRSFDGELRKVEDGIYHSNSLRNCLTALQSSLANENKIERIYI
IGGGEIYRQSMDLADHWLITKIMPLPETTIPQMDTFLQKQELEQRFYDNSDKLVDFLPSS
IQLEGRLTSQEWNGELVKGLPVQEKGYQFYFTLYTKK
|
|
|
|---|
| BDBM50298809 |
|---|
| n/a |
|---|
| Name | BDBM50298809 |
|---|
| Synonyms: | (+/-)-5-(3-(4',5-dimethoxybiphenyl-3-yl)but-1-ynyl)-6-methylpyrimidine-2,4-diamine | Biphenyl antifolate, 25 | CHEMBL572485 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24N4O2 |
|---|
| Mol. Mass. | 388.4623 |
|---|
| SMILES | COc1ccc(cc1)-c1cc(OC)cc(c1)C(C)C#Cc1c(C)nc(N)nc1N |
|---|
| Structure | 
|
|---|
Search and Browse
