| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 1 |
|---|
| Ligand | BDBM50137677 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhbition Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 293.15±0 K |
|---|
| Ki | 1000±0.0 nM |
|---|
| Citation |  Winum, JY; Montero, JL; Vullo, D; Supuran, CT Carbonic anhydrase inhibitors: glycosylsulfanilamides act as subnanomolar inhibitors of the human secreted isoform VI. Chem Biol Drug Des74:636-9 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 1 |
|---|
| Name: | Carbonic anhydrase 1 |
|---|
| Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28873.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00915 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
|---|
| BDBM50137677 |
|---|
| n/a |
|---|
| Name | BDBM50137677 |
|---|
| Synonyms: | 4-(3,4,5-Trihydroxy-6-hydroxymethyl-tetrahydro-pyran-2-ylamino)-benzenesulfonamide | CHEMBL72447 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 1 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 2 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H18N2O7S |
|---|
| Mol. Mass. | 334.346 |
|---|
| SMILES | NS(=O)(=O)c1ccc(NC2OC(CO)C(O)C(O)C2O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
