Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM50137677
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhbition Assay
pH7.5±0
Temperature293.15±0 K
Ki 0.64±0 nM
Citation Winum JYMontero JLVullo DSupuran CT Carbonic anhydrase inhibitors: glycosylsulfanilamides act as subnanomolar inhibitors of the human secreted isoform VI. Chem Biol Drug Des 74:636-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137677
n/a
NameBDBM50137677
Synonyms:4-(3,4,5-Trihydroxy-6-hydroxymethyl-tetrahydro-pyran-2-ylamino)-benzenesulfonamide | CHEMBL72447 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 1 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 2 | N-(p-sulfamoylphenyl)-alpha-glycopyranosylamine, 3
TypeSmall organic molecule
Emp. Form.C12H18N2O7S
Mol. Mass.334.346
SMILESNS(=O)(=O)c1ccc(NC2OC(CO)C(O)C(O)C2O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: