Reaction Details |
| Report a problem with these data |
Target | Beta-nerve growth factor |
---|
Ligand | BDBM50035398 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_222 |
---|
Citation | Arneric, SP; Sullivan, JP; Briggs, CA; Donnelly-Roberts, D; Anderson, DJ; Raszkiewicz, JL; Hughes, ML; Cadman, ED; Adams, P; Garvey, DS (S)-3-methyl-5-(1-methyl-2-pyrrolidinyl) isoxazole (ABT 418): a novel cholinergic ligand with cognition-enhancing and anxiolytic activities: I. In vitro characterization. J Pharmacol Exp Ther270:310-8 (1994) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Beta-nerve growth factor |
---|
Name: | Beta-nerve growth factor |
Synonyms: | Beta-NGF | NGF | NGFB | NGF_HUMAN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 26977.12 |
Organism: | Homo sapiens (Human) |
Description: | P01138 |
Residue: | 241 |
Sequence: | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
|
|
|
BDBM50035398 |
---|
n/a |
---|
Name | BDBM50035398 |
Synonyms: | (S)-1-Methyl-2-(3-methyl-isoxazol-5-yl)-pyrrolidinium | (S)-3-methyl-5-(1-methylpyrrolidin-2-yl)isoxazole | 3-Methyl-5-((S)-1-methyl-pyrrolidin-2-yl)-isoxazole | ABT-418 | CHEMBL274525 |
Type | Small organic molecule |
Emp. Form. | C9H14N2O |
Mol. Mass. | 166.2203 |
SMILES | CN1CCC[C@H]1c1cc(C)no1 |r| |
Structure |
|